IPMK Rabbit Polyclonal Antibody

CAT#: TA337886

Rabbit Polyclonal Anti-IPMK Antibody

Product Images

Host: Rabbit; Target Name: IPMK; Sample Tissue: Hela Whole cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-IPMK antibody is: synthetic peptide directed towards the middle region of Human IPMK. Synthetic peptide located within the following region: SDSYETENQHYGRSLTKETIKDGVSRFFHNGYCLRKDAVAASIQKIEKIL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 45 kDa
• Gene Name: inositol polyphosphate multikinase
• Database Link:
  NP_689416
  Entrez Gene 253430 Human
  UniProt ID Q8NFU5
• Background: This gene encodes a member of the inositol phosphokinase family. The encoded protein has 3-kinase, 5-kinase and 6-kinase activities on phosphorylated inositol substrates. The encoded protein plays an important role in the biosynthesis of inositol 1,3,4,5,6-pentakisphosphate, and has a preferred 5-kinase activity. This gene may play a role in nuclear mRNA export. Pseudogenes of this gene are located on the long arm of chromosome 13 and the short arm of chromosome 19.
• Synonyms: Impk; inositol polyphosphate kinase 2; inositol polyphosphate multikinase; Ipk2
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 93%; Rat: 93%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Yeast: 85%; Mouse: 79%; Zebrafish: 77%

Reference Data

• Protein Pathways: Inositol phosphate metabolism