HMGA1 Rabbit Polyclonal Antibody

CAT#: TA337894

Rabbit Polyclonal Anti-Hmga1 Antibody

Product Images

WB Suggested Anti-Hmga1 Antibody; Titration: 2 ug/ml; Positive Control: Rat Small Intestine

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Hmga1 antibody is: synthetic peptide directed towards the N-terminal region of Rat Hmga1. Synthetic peptide located within the following region: MSESGSKSSQPLASKQEKDGTEKRGRGRPRKQPSVSPGTALVGSQKEPSE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 11 kDa
• Gene Name: high mobility group AT-hook 1
• Database Link:
  NP_665906
  Entrez Gene 117062 Rat
  UniProt ID P17096
• Background: Hmga1 is expressed in metastatic prostate tumors and may be associated with transformation.
• Synonyms: HMG-R; HMGA1A; HMGIY
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Bovine: 93%; Guinea pig: 93%

Reference Data

• Protein Families: Druggable Genome, Stem cell - Pluripotency, Stem cell relevant signaling - JAK/STAT signaling pathway, Transcription Factors