PSIP1 Rabbit Polyclonal Antibody

CAT#: TA338014

Rabbit Polyclonal Anti-PSIP1 Antibody

Product Images

WB Suggested Anti-PSIP1 Antibody Titration: 1.25 ug/ml; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PSIP1 antibody: synthetic peptide directed towards the N terminal of human PSIP1. Synthetic peptide located within the following region: DNNPKVKFSSQQAATKQSNASSDVEVEEKETSVSKEDTDHEEKASNEDVT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 38 kDa
• Gene Name: PC4 and SFRS1 interacting protein 1
• Database Link:
  NP_066967
  Entrez Gene 11168 Human
  UniProt ID O75475
• Background: PSIP1 encodes a multidomain adaptor protein that interacts with the nuclear import apparatus, lentiviral IN proteins and chromatin by means of an NLS, an IBD and additional chromatin-interacting domains.
• Synonyms: DFS70; LEDGF; p52; p75; PAIP; PSIP2
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Rat: 93%; Guinea pig: 93%; Mouse: 86%

Reference Data

• Protein Families: Stem cell - Pluripotency, Transcription Factors