CHRDL2 Rabbit Polyclonal Antibody

CAT#: TA338064

Rabbit Polyclonal Anti-CHRDL2 Antibody

Product Images

WB Suggested Anti-CHRDL2 Antibody; Titration: 1.0 ug/ml; Positive Control: Hela Whole cell

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CHRDL2 antibody is: synthetic peptide directed towards the N-terminal region of Human CHRDL2. Synthetic peptide located within the following region: CTEGQIYCGLTTCPEPGCPAPLPLPDSCCQACKDEASEQSDEEDSVQSLH
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 3 kDa
• Gene Name: chordin-like 2
• Database Link:
  NP_056239
  Entrez Gene 25884 Human
  UniProt ID Q6WN34
• Background: CHRDL2 is implicated in tumor angiogenesis. CHRDL2 may inhibits BMPs activity by blocking their interaction with their receptors. CHRDL2 has a negative regulator effect on the cartilage formation/regeneration from immature mesenchymal cells, by preventing or reducing the rate of matrix accumulation. CHRDL2 may play a role during myoblast and osteoblast differentiation, and maturation.
• Synonyms: BNF1; CHL2
• Note: Immunogen Sequence Homology: Human: 100%; Yeast: 90%; Mouse: 83%; Rat: 75%

Reference Data

• Protein Families: Secreted Protein