PISD Rabbit Polyclonal Antibody

CAT#: TA338091

Rabbit Polyclonal Anti-PISD Antibody

Product Images

WB Suggested Anti-PISD Antibody; Titration: 1.0 ug/ml; Positive Control: 721_B Whole Cell PISD is supported by BioGPS gene expression data to be expressed in 721_B

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PISD antibody is: synthetic peptide directed towards the C-terminal region of Human PISD. Synthetic peptide located within the following region: WKHGFFSLTAVGATNVGSIRIYFDRDLHTNSPRHSKGSYNDFSFVTHTNR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 43 kDa
• Gene Name: phosphatidylserine decarboxylase
• Database Link:
  NP_055153
  Entrez Gene 23761 Human
  UniProt ID Q9UG56
• Background: Phosphatidylserine decarboxylases catalyze the formation of phosphatidylethanolamine (PE) by decarboxylation of phosphatidylserine (PS). Type I PSDs, such as PISD, are targeted to the inner mitochondrial membrane by an N-terminal targeting sequence. PISD also contains a conserved LGST motif that functions as an autocatalytic cleavage site where the proenzyme is split into mature alpha and beta subunits.
• Synonyms: DJ858B16; dJ858B16.2; PSD; PSDC; PSSC
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Mouse: 92%

Reference Data

• Protein Pathways: Glycerophospholipid metabolism, Metabolic pathways