CD300C Rabbit Polyclonal Antibody

CAT#: TA338125

Rabbit Polyclonal Anti-CD300C Antibody

Product Images

WB Suggested Anti-CD300C Antibody; Titration: 1.0 ug/ml; Positive Control: 721_B Whole Cell

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CD300C antibody is: synthetic peptide directed towards the C-terminal region of Human CD300C. Synthetic peptide located within the following region: MGTSGPPTKLPVHTWPSVTRKDSPEPSPHPGSLFSNVRFLLLVLLELPLL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 23 kDa
• Gene Name: CD300c molecule
• Database Link:
  NP_006669
  Entrez Gene 10871 Human
  UniProt ID Q08708
• Background: The CMRF35 antigen, which was identified by reactivity with a monoclonal antibody, is present on monocytes, neutrophils, and some T and B lymphocytes.
• Synonyms: CLM-6; CMRF-35; CMRF-35A; CMRF35; CMRF35-A1; CMRF35A; CMRF35A1; IGSF16; LIR
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Druggable Genome, Transmembrane