SGPL1 Rabbit Polyclonal Antibody

CAT#: TA338200

Rabbit Polyclonal Anti-SGPL1 Antibody

Product Images

WB Suggested Anti-SGPL1 Antibody; Titration: 1.0 ug/ml; Positive Control: 721_B Whole Cell. There is BioGPS gene expression data showing that SGPL1 is expressed in 721_B

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SGPL1 antibody is: synthetic peptide directed towards the C-terminal region of Human SGPL1. Synthetic peptide located within the following region: IHFCITLLHARKRVAIQFLKDIRESVTQIMKNPKAKTTGMGAIYGMAQTT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 63 kDa
• Gene Name: sphingosine-1-phosphate lyase 1
• Database Link:
  NP_003892
  Entrez Gene 8879 Human
  UniProt ID O95470
• Background: SGPL1 cleaves phosphorylated sphingoid bases (PSBs), such as sphingosine-1-phosphate, into fatty aldehydes and phosphoethanolamine. SGPL1 elevates stress-induced ceramide production and apoptosis.
• Synonyms: S1PL; SPL
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Goat: 93%; Zebrafish: 91%; Guinea pig: 86%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Metabolic pathways, Sphingolipid metabolism