OGR1 (GPR68) Rabbit Polyclonal Antibody
Other products for "GPR68"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-GPR68 antibody is: synthetic peptide directed towards the middle region of Human GPR68. Synthetic peptide located within the following region: SIYFLMHEEVIEDENQHRVCFEHYPIQAWQRAINYYRFLVGFLFPICLLL |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 41 kDa |
Gene Name | G protein-coupled receptor 68 |
Database Link | |
Background | Proton-sensing receptor is involved in pH homeostasis. GPR68 may represents an osteoblastic pH sensor regulating cell-mediated responses to acidosis in bone. GPR68 mediates its action by association with G proteins that stimulates inositol phosphate (IP) production or Ca2+ mobilization. The receptor is almost silent at pH 7.8 but fully activated at pH 6.8. Function also as a metastasis suppressor gene in prostate cancer. |
Synonyms | GPR12A; OGR1 |
Note | Immunogen Sequence Homology: Human: 100%; Horse: 93%; Mouse: 93%; Rat: 86%; Dog: 79%; Pig: 79%; Rabbit: 79% |
Reference Data | |
Protein Families | Druggable Genome, GPCR, Transmembrane |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.