Netrin 4 (NTN4) Rabbit Polyclonal Antibody

CAT#: TA338467

Rabbit Polyclonal Anti-NTN4 Antibody

Product Images

WB Suggested Anti-NTN4 Antibody Titration: 0.2-1 ug/ml; Positive Control: MCF7 cell lysate

• 

  rat and mouse brain

Specifications

Product Data

• Applications: IF, WB
• Recommended Dilution: WB, IF
• Reactivities: Human, Mouse, Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NTN4 antibody: synthetic peptide directed towards the N terminal of human NTN4. Synthetic peptide located within the following region: EDVHREKIQLDLEAEFYFTHLIVMFKSPRPAAMVLDRSQDFGKTWKPYKY
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 70 kDa
• Gene Name: netrin 4
• Database Link:
  NP_067052
  Entrez Gene 57764 MouseEntrez Gene 299737 RatEntrez Gene 59277 Human
  UniProt ID Q9HB63
• Background: NTN4 contains 3 laminin EGF-like domains, 1 laminin N-terminal domain and 1 NTR domain. NTN4 may play an important role in neural, kidney and vascular development. It promotes neurite elongation from olfactory bulb explants. NTN4 belongs to a family of proteins related to laminins (see LAMA1, MIM 150320) Koch et al. (2000) [PubMed 11038171]. [supplied by OMIM]
• Synonyms: PRO3091
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Transmembrane
• Protein Pathways: Axon guidance