GABA A Receptor alpha 1 (GABRA1) Rabbit Polyclonal Antibody

CAT#: TA338499

Rabbit Polyclonal Anti-GABRA1 Antibody

Product Images

WB Suggested Anti-GABRA1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GABRA1 antibody: synthetic peptide directed towards the N terminal of human GABRA1. Synthetic peptide located within the following region: WAWILLLSTLTGRSYGQPSLQDELKDNTTVFTRILDRLLDGYDNRLRPGL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 52 kDa
• Gene Name: gamma-aminobutyric acid type A receptor alpha1 subunit
• Database Link:
  NP_000797
  Entrez Gene 2554 Human
  UniProt ID P14867
• Background: This gene encodes a gamma-aminobutyric acid (GABA) receptor. GABA is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABA-A receptors, which are ligand-gated chloride channels. Chloride conductance of these channels can be modulated by agents such as benzodiazepines that bind to the GABA-A receptor. GABA-A receptors are pentameric, consisting of proteins from several subunit classes: alpha, beta, gamma, delta and rho. Mutations in this gene cause juvenile myoclonic epilepsy and childhood absence epilepsy type 4. Multiple transcript variants encoding the same protein have been identified for this gene. [provided by RefSeq, Jul 2008]
• Synonyms: ECA4; EIEE19; EJM; EJM5
• Note: Immunogen Sequence Homology: Human: 100%; Bovine: 100%; Rabbit: 100%; Dog: 93%; Rat: 92%; Mouse: 92%; Pig: 86%

Reference Data

• Protein Families: Druggable Genome, Ion Channels: Cys-loop Receptors, Transmembrane
• Protein Pathways: Neuroactive ligand-receptor interaction