Antibodies

Jump to Filters
View as table Download
Gabra1 Rabbit Polyclonal Antibody
TA328809

USD 585.00

3 Weeks

Rabbit Polyclonal Anti-GABA (A) alpha1 Receptor (extracellular)

Applications IHC, WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide QPSQDELKDNTTVFTR(C), corresponding to amino acid residues 28-43 of rat GABA (A) a1 Receptor. Extracellular, N-terminus.
GABA A Receptor alpha 1 (GABRA1) Rabbit Polyclonal Antibody
AP20674PU-N

USD 370.00

2 Weeks

GABA A Receptor alpha 1 (GABRA1) rabbit polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Human, Mouse, Rat
Gabra1 Rabbit Polyclonal Antibody
TA309123

USD 415.00

5 Days

Rabbit Anti-GABAA Receptor a 1 Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein from the cytoplasmic loop of the alpha 1 subunit
Gabra1 Rabbit Polyclonal Antibody
TA309124

USD 415.00

5 Days

Rabbit Anti-GABAA Receptor a 1, N-Terminus Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to amino acid residues from the N-terminal region conjugated to KLH
GABA A Receptor alpha 1 (GABRA1) Rabbit Polyclonal Antibody
TA338499

USD 375.00

5 Days

Rabbit Polyclonal Anti-GABRA1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GABRA1 antibody: synthetic peptide directed towards the N terminal of human GABRA1. Synthetic peptide located within the following region: WAWILLLSTLTGRSYGQPSLQDELKDNTTVFTRILDRLLDGYDNRLRPGL
GABA A Receptor alpha 1 (GABRA1) Rabbit Polyclonal Antibody
TA338500

USD 375.00

5 Days

Rabbit Polyclonal Anti-GABRA1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GABRA1 antibody: synthetic peptide directed towards the middle region of human GABRA1. Synthetic peptide located within the following region: YDLLGQTVDSGIVQSSTGEYVVMTTHFHLKRKIGYFVIQTYLPCIMTVIL
GABA A Receptor alpha 1 (GABRA1) Rabbit Polyclonal Antibody
TA351205

USD 345.00

In Stock

Rabbit Polyclonal Anti-GABRA1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human GABRA1
GABRA1 Rabbit Polyclonal Antibody
TA367060

USD 380.00

4 Weeks

GABRA1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human GABRA1
GABA A Receptor alpha 1 (GABRA1) Rabbit Polyclonal Antibody
TA376441

USD 220.00

3 Weeks

GABRA1 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 28-251 of human GABRA1 (NP_000797.2).
Modifications Unmodified
GABA A Receptor alpha 1 (GABRA1) Rabbit Monoclonal Antibody [Clone ID: 1F4]
TA386322

USD 523.00

2 Weeks

Recombinant Anti-GABAR (Clone 1F4)

Reactivities Human
Conjugation Unconjugated
Modifications This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG2b format, for improved compatibility with existing reagents, assays and techniques.