MOSC1 (MARC1) Rabbit Polyclonal Antibody

CAT#: TA338615

Rabbit Polyclonal Anti-MARC1 Antibody

Product Images

WB Suggested Anti-MARC1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: Human Placenta

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MOSC1 antibody: synthetic peptide directed towards the C terminal of human MOSC1. Synthetic peptide located within the following region: WDELLIGDVELKRVMACSRCILTTVDPDTGVMSRKEPLETLKSYRQCDPS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 37 kDa
• Gene Name: mitochondrial amidoxime reducing component 1
• Database Link:
  NP_073583
  Entrez Gene 64757 Human
  UniProt ID Q5VT66
• Background: The exact function of MARC1 remains unknown.
• Synonyms: MOSC1
• Note: Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Pig: 92%; Zebrafish: 92%; Guinea pig: 92%

Reference Data

• Protein Families: Transmembrane