LPCAT1 Rabbit Polyclonal Antibody

CAT#: TA338682

Rabbit Polyclonal Anti-LPCAT1 Antibody

Product Images

WB Suggested Anti-LPCAT1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Human Small Intestine

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-LPCAT1 antibody: synthetic peptide directed towards the middle region of human LPCAT1. Synthetic peptide located within the following region: LRLPADTCLLEFARLVRGLGLKPEKLEKDLDRYSERARMKGGEKIGIAEF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 59 kDa
• Gene Name: lysophosphatidylcholine acyltransferase 1
• Database Link:
  NP_079106
  Entrez Gene 79888 Human
  UniProt ID Q8NF37
• Background: Lysophosphatidylcholine (LPC) acyltransferase (LPCAT; EC 2.3.1.23) catalyzes the conversion of LPC to phosphatidylcholine (PC) in the remodeling pathway of PC biosynthesis.
• Synonyms: AGPAT9; AGPAT10; AYTL2; lpcat; LPCAT-1; lysoPAFAT; PFAAP3
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Bovine: 93%; Zebrafish: 92%; Guinea pig: 79%

Reference Data

• Protein Families: Transmembrane