OCIAD2 Rabbit Polyclonal Antibody

CAT#: TA338837

Rabbit Polyclonal Anti-OCIAD2 Antibody

Product Images

WB Suggested Anti-OCIAD2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: 293T cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-OCIAD2 antibody: synthetic peptide directed towards the middle region of human OCIAD2. Synthetic peptide located within the following region: QGYLAANSRFGSLPKVALAGLLGFGLGKVSYIGVCQSKFHFFEDQLRGAG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 17 kDa
• Gene Name: OCIA domain containing 2
• Database Link:
  NP_001014446
  Entrez Gene 132299 Human
  UniProt ID Q56VL3
• Background: The exact function of OCIAD2 is not known.
• Synonyms: DKFZp686C03164; MGC45416
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Dog: 86%