ZADH1 (PTGR2) Rabbit Polyclonal Antibody

CAT#: TA338852

Rabbit Polyclonal Anti-PTGR2 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "PTGR2"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-ZADH1 antibody: synthetic peptide directed towards the middle region of human ZADH1. Synthetic peptide located within the following region: ILDGNSLEKVDPQLVDGHLSYFLGAIGMPGLTSLIGIQEKGHITAGSNKT
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 38 kDa
Gene Name prostaglandin reductase 2
Background PTGR2 is an enzyme involved in the metabolism of prostaglandins. PTGR2 catalyzes the NADPH-dependent conversion of 15-keto-prostaglandin E2 to 15-keto-13,14-dihydro-prostaglandin E2. PTGR2 may also be involved in regulating activation of the peroxisome proliferator-activated receptor.
Synonyms HEL-S-298; PGR2; ZADH1
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 93%; Rabbit: 86%
Reference Data
Protein Families Druggable Genome

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.