OSTA (SLC51A) Rabbit Polyclonal Antibody

CAT#: TA338900

Rabbit Polyclonal Anti-SLC51A Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "SLC51A"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-OSTalpha antibody: synthetic peptide directed towards the middle region of human OSTalpha. Synthetic peptide located within the following region: LLMLGPFQYAFLKITLTLVGLFLVPDGIYDPADISEGSTALWINTFLGVS
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 38 kDa
Gene Name solute carrier family 51 alpha subunit
Background SLC51A is essential component of the Ost-alpha/Ost-beta complex, a heterodimer that acts as the intestinal basolateral transporter responsible for bile acid export from enterocytes into portal blood.SLC51A efficiently transports the major species of bile acids.
Synonyms OSTA; OSTalpha
Note Immunogen Sequence Homology: Dog: 100%; Horse: 100%; Human: 100%; Pig: 92%; Rat: 92%; Rabbit: 92%; Guinea pig: 92%; Bovine: 86%; Mouse: 83%
Reference Data
Protein Families Transmembrane

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.