C21orf91 Rabbit Polyclonal Antibody

CAT#: TA338937

Rabbit Polyclonal Anti-C21orf91 Antibody

Product Images

WB Suggested Anti-C21orf91 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 12500; Positive Control: Human Lung

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-C21orf91 antibody: synthetic peptide directed towards the middle region of human C21orf91. Synthetic peptide located within the following region: LCRNSVLWPHSHNQAQKKEETISSPEANVQTQHPHYSREELNSMTLGEVE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 34 kDa
• Gene Name: chromosome 21 open reading frame 91
• Database Link:
  NP_059143
  Entrez Gene 54149 Human
  UniProt ID Q9NYK6
• Background: The exact function of C21orf91 remains unknown.
• Synonyms: C21orf14; C21orf38; CSSG1; EURL; YG81
• Note: Immunogen Sequence Homology: Pig: 100%; Human: 100%; Bovine: 100%; Dog: 93%; Horse: 93%; Mouse: 93%; Rabbit: 93%; Rat: 86%