C21ORF56 (SPATC1L) Rabbit Polyclonal Antibody

CAT#: TA338948

Rabbit Polyclonal Anti-C21orf56 Antibody

Product Images

WB Suggested Anti-C21orf56 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Transfected 293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-C21orf56 antibody: synthetic peptide directed towards the N terminal of human C21orf56. Synthetic peptide located within the following region: MVRPKKVCFSESSLPTGDRTRRSYYLNEIQSFAGAEKDARVVGEIAFQLD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 21 kDa
• Gene Name: spermatogenesis and centriole associated 1-like
• Database Link:
  NP_115637
  Entrez Gene 84221 Human
  UniProt ID Q9H0A9
• Background: The specific function of C21orf56 is not yet known.
• Synonyms: C21orf56
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Horse: 93%; Bovine: 93%; Pig: 86%; Rat: 86%; Mouse: 86%; Guinea pig: 79%