ZMPSTE24 Rabbit Polyclonal Antibody

CAT#: TA339028

Rabbit Polyclonal Anti-ZMPSTE24 Antibody

Product Images

WB Suggested Anti-ZMPSTE24 Antibody Titration: 0.2-1 ug/ml; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZMPSTE24 antibody: synthetic peptide directed towards the N terminal of human ZMPSTE24. Synthetic peptide located within the following region: LYSETEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 55 kDa
• Gene Name: zinc metallopeptidase STE24
• Database Link:
  NP_005848
  Entrez Gene 10269 Human
  UniProt ID O75844
• Background: This gene encodes a member of the peptidase M48A family. The encoded protein is a zinc metalloproteinase involved in the two step post-translational proteolytic cleavage of carboxy terminal residues of farnesylated prelamin A to form mature lamin A. Mutations in this gene have been associated with mandibuloacral dysplasia and restrictive dermopathy. [provided by RefSeq, Jul 2008]
• Synonyms: FACE-1; FACE1; HGPS; PRO1; STE24; Ste24p
• Note: Immunogen Sequence Homology: Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Dog: 93%; Rat: 91%; Zebrafish: 90%; Pig: 86%; Guinea pig: 86%; Mouse: 79%

Reference Data

• Protein Families: Druggable Genome, Protease, Transmembrane