FUBP1 Rabbit Polyclonal Antibody

CAT#: TA339085

Rabbit Polyclonal Anti-FUBP1 Antibody

Product Images

WB Suggested Anti-FUBP1 Antibody Titration: 1.25 ug/ml; ELISA Titer: 1:62500; Positive Control: Human brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-FUBP1 antibody: synthetic peptide directed towards the N terminal of human FUBP1. Synthetic peptide located within the following region: QIAAKIGGDAGTSLNSNDYGYGGQKRPLEDGDQPDAKKVAPQNDSFGTQL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 68 kDa
• Gene Name: far upstream element binding protein 1
• Database Link:
  NP_003893
  Entrez Gene 51886 MouseEntrez Gene 8880 Human
  UniProt ID Q96AE4
• Background: This gene encodes a ssDNA binding protein that activates the far upstream element (FUSE) of c-myc and stimulates expression of c-myc in undifferentiated cells. Regulation of FUSE by FUBP occurs through single-strand binding of FUBP to the non-coding strand. This protein has been shown to function as an ATP-dependent DNA helicase. [provided by RefSeq, Jul 2008]
• Synonyms: FBP; FUBP; hDH V
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%

Reference Data

• Protein Families: Stem cell - Pluripotency, Transcription Factors