Glutamyl Prolyl tRNA synthetase (EPRS) Rabbit Polyclonal Antibody

CAT#: TA339272

Rabbit Polyclonal Anti-EPRS Antibody

Product Images

WB Suggested Anti-EPRS Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: 293T cell lysate.EPRS is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-EPRS antibody: synthetic peptide directed towards the middle region of human EPRS. Synthetic peptide located within the following region: GKIVQIPFCGEIDCEDWIKKTTARDQDLEPGAPSMGAKSLCIPFKPLCEL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 170 kDa
• Gene Name: glutamyl-prolyl-tRNA synthetase
• Database Link:
  NP_004437
  Entrez Gene 2058 Human
  UniProt ID P07814
• Background: Aminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids. The protein encoded by this gene is a multifunctional aminoacyl-tRNA synthetase that catalyzes the aminoacylation of glutamic acid and proline tRNA species. Alternative splicing has been observed for this gene, but the full-length nature and biological validity of the variant have not been determined. [provided by RefSeq, Jul 2008]
• Synonyms: EARS; GLUPRORS; PARS; PIG32; QARS; QPRS
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Rat: 93%; Zebrafish: 93%; Mouse: 86%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Aminoacyl-tRNA biosynthesis, Metabolic pathways, Porphyrin and chlorophyll metabolism