PIP3E (IPCEF1) Rabbit Polyclonal Antibody

CAT#: TA339329

Rabbit Polyclonal Anti-PIP3-E Antibody

Product Images

WB Suggested Anti-PIP3-E Antibody Titration: 0.2-1 ug/ml; Positive Control: 721_B cell lysate.IPCEF1 is supported by BioGPS gene expression data to be expressed in 721_B

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PIP3-E antibody: synthetic peptide directed towards the middle region of human PIP3-E. Synthetic peptide located within the following region: IHKALENSFVTSESGFLNSLSSDDTSSLSSNHDHLTVPDKPAGSKIMDKE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 49 kDa
• Gene Name: interaction protein for cytohesin exchange factors 1
• Database Link:
  NP_056368
  Entrez Gene 26034 Human
  UniProt ID Q8WWN9
• Background: Enhances the promotion of guanine-nucleotide exchange by PSCD2 on ARF6 in a concentration-dependent manner.
• Synonyms: PIP3-E
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Rat: 93%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Pig: 86%; Guinea pig: 86%; Mouse: 79%