CDT1 Rabbit Polyclonal Antibody

CAT#: TA339369

Rabbit Polyclonal Anti-CDT1 Antibody

Product Images

WB Suggested Anti-CDT1 Antibody Titration: 0.2-1 ug/ml; Positive Control: HepG2 cell lysate

• 

  Sample Type: 3. rat brain extract (80ug); Primary Antibody Dilution: 2 ug/ml; Secondary Antibody: IRDye 800CW goat anti-rabbit from Li-COR Bioscience; Secondary Antibody Dilution: 1: 20, 000; Image Submitted by: Yuzhi Chen; University of Arkansas for Medi

• 

  HC Suggested Anti-CDT1 antibody; Titration: 2 ug/ml; Positive Control: Mouse brain stem cells

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human, Mouse, Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CDT1 antibody: synthetic peptide directed towards the C terminal of human CDT1. Synthetic peptide located within the following region: PATPPATPPAASPSALKGVSQDLLERIRAKEAQKQLAQMTRCPEQEQRLQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 60 kDa
• Gene Name: chromatin licensing and DNA replication factor 1
• Database Link:
  NP_112190
  Entrez Gene 67177 MouseEntrez Gene 292071 RatEntrez Gene 81620 Human
  UniProt ID Q9H211
• Background: The protein encoded by this gene is involved in the formation of the pre-replication complex that is necessary for DNA replication. The encoded protein can bind geminin, which prevents replication and may function to prevent this protein from initiating replication at inappropriate origins. Phosphorylation of this protein by cyclin A-dependent kinases results in degradation of the protein. [provided by RefSeq, Mar 2011]
• Synonyms: DUP; RIS2
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 93%; Rabbit: 93%; Yeast: 85%; Dog: 77%

Reference Data

• Protein Families: Stem cell - Pluripotency