Pokemon (ZBTB7A) Rabbit Polyclonal Antibody

CAT#: TA339480

Rabbit Polyclonal Anti-ZBTB7A Antibody

Product Images

WB Suggested Anti-ZBTB7A Antibody Titration: 1.25 ug/ml; ELISA Titer: 1:12500; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZBTB7A antibody: synthetic peptide directed towards the middle region of human ZBTB7A. Synthetic peptide located within the following region: PPAERPPTGDGDEGDSNPGLWPERDEDAPTGGLFPPPVAPPAATQNGHYG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 61 kDa
• Gene Name: zinc finger and BTB domain containing 7A
• Database Link:
  NP_056982
  Entrez Gene 51341 Human
  UniProt ID O95365
• Background: Plays a key role in the instruction of early lymphoid progenitors to develop into B lineage by repressing T-cell instructive Notch signals (By similarity). Specifically represses the transcription of the CDKN2A gene. Efficiently abrogates E2F1-dependent CDKN2A transactivation/de-repression. Binds to the consensus sequence 5'-[GA][CA]GACCCCCCCCC-3'.
• Synonyms: FBI-1; FBI1; LRF; pokemon; TIP21; ZBTB7; ZNF857A
• Note: Immunogen Sequence Homology: Human: 100%; Bovine: 93%; Pig: 86%; Rat: 85%; Mouse: 85%; Dog: 79%

Reference Data

• Protein Families: Transcription Factors