Pokemon (ZBTB7A) Rabbit Polyclonal Antibody

CAT#: TA339481

Rabbit Polyclonal Anti-ZBTB7A Antibody

Product Images

Host: Rabbit; Target Name: ZBTB7A; Sample Tissue: Liver Tumor lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ZBTB7A antibody is: synthetic peptide directed towards the N-terminal region of Human ZBTB7A. Synthetic peptide located within the following region: MNSLPPAAAAAAASFPWSAFGASDDDLDATKEAVAAAVAAVAAGDCNGLD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 64 kDa
• Gene Name: zinc finger and BTB domain containing 7A
• Database Link:
  NP_056982
  Entrez Gene 51341 Human
  UniProt ID O95365
• Background: Plays a key role in the instruction of early lymphoid progenitors to develop into B lineage by repressing T-cell instructive Notch signals (By similarity). Specifically represses the transcription of the CDKN2A gene. Efficiently abrogates E2F1-dependent CDKN2A transactivation/de-repression. Binds to the consensus sequence 5'-[GA][CA]GACCCCCCCCC-3'.
• Synonyms: FBI-1; FBI1; LRF; pokemon; TIP21; ZBTB7; ZNF857A
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Human: 100%; Guinea pig: 100%; Bovine: 93%; Mouse: 86%; Rat: 83%

Reference Data

• Protein Families: Transcription Factors