WIZ Rabbit Polyclonal Antibody

CAT#: TA339533

Rabbit Polyclonal Anti-Wiz Antibody

Product Images

Host: Rabbit; Target Name: Wiz; Sample Tissue: Mouse Spleen lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Wiz antibody is: synthetic peptide directed towards the C-terminal region of MOUSE Wiz. Synthetic peptide located within the following region: TSPPGTVKSEEHQRQNINKFERRQARPSDASAARGGEEVNDLQQKLEEVR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 105 kDa
• Gene Name: widely interspaced zinc finger motifs
• Database Link:
  NP_067064
  Entrez Gene 22404 Mouse
  UniProt ID O95785
• Background: Wiz may link EHMT1 and EHMT2 histone methyltransferases to the CTBP corepressor machinery. It may be involved in EHMT1-EHMT2 heterodimer formation and stabilization.
• Synonyms: ZNF803
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Mouse: 93%; Rabbit: 86%