TRAF3IP3 Rabbit Polyclonal Antibody

CAT#: TA339551

Rabbit Polyclonal Anti-TRAF3IP3 Antibody

Product Images

WB Suggested Anti-TRAF3IP3 Antibody Titration: 0.2-1 ug/ml; Positive Control: Jurkat cell lysateTRAF3IP3 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TRAF3IP3 antibody: synthetic peptide directed towards the middle region of human TRAF3IP3. Synthetic peptide located within the following region: KQKMVILQDLLSTLIQASDSSWKGQLNEDKLKGKLRSLENQLYTCTQKYS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 61 kDa
• Gene Name: TRAF3 interacting protein 3
• Database Link:
  NP_079504
  Entrez Gene 80342 Human
  UniProt ID Q9Y228
• Background: TRAF3IP3 stimulated cell growth by modulating the c-Jun N-terminal kinase (JNK) pathway. TRAF3 interacts with Smac/DIABLO via TRAF domain, leading to an increased proapoptotic effect of Smac/DIABLO in cytoplasm.
• Synonyms: T3JAM
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome, Transmembrane