DCSTAMP Rabbit Polyclonal Antibody

CAT#: TA339561

Rabbit Polyclonal Anti-DCSTAMP Antibody

Product Images

WB Suggested Anti-DCSTAMP Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 12500; Positive Control: OVCAR-3 cell lysateDCSTAMP is supported by BioGPS gene expression data to be expressed in OVCAR3

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TM7SF4 antibody: synthetic peptide directed towards the N terminal of human TM7SF4. Synthetic peptide located within the following region: AGTGIVILGHVENIFHNFKGLLDGMTCNLRAKSFSIHFPLLKKYIEAIQW
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 53 kDa
• Gene Name: dendrocyte expressed seven transmembrane protein
• Database Link:
  NP_110415
  Entrez Gene 81501 Human
  UniProt ID Q9H295
• Background: Dendritic cells are unique in their ability to present antigen to naive T cells, and therefore play a central role in the initiation of immune responses. The protein encoded by this gene is a transmembrane molecule that is preferentially expressed by dendritic cells. Its expression is down-regulated by ligation of the CD40 molecule. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined.
• Synonyms: FIND; hDC-STAMP; TM7SF4
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Guinea pig: 100%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Mouse: 92%

Reference Data

• Protein Families: Druggable Genome, Transmembrane