TMEM166 (EVA1A) Rabbit Polyclonal Antibody
Other products for "EVA1A"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-TMEM166 antibody: synthetic peptide directed towards the N terminal of human TMEM166. Synthetic peptide located within the following region: RLPLSHSPEHVEMALLSNILAAYSFVSENPERAALYFVSGVCIGLVLTLA |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 17 kDa |
Gene Name | eva-1 homolog A, regulator of programmed cell death |
Database Link | |
Background | EVA1A belongs to the FAM176 family. It acts as a regulator of programmed cell death, mediating both autophagy and apoptosis. |
Synonyms | FAM176A; TMEM166 |
Note | Immunogen Sequence Homology: Dog: 100%; Horse: 100%; Human: 100%; Rabbit: 93%; Pig: 86%; Guinea pig: 86%; Mouse: 79% |
Reference Data | |
Protein Families | Transmembrane |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.