TMEM166 (EVA1A) Rabbit Polyclonal Antibody

CAT#: TA339601

Rabbit Polyclonal Anti-EVA1A Antibody

Product Images

WB Suggested Anti-EVA1A Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: 293T cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TMEM166 antibody: synthetic peptide directed towards the N terminal of human TMEM166. Synthetic peptide located within the following region: RLPLSHSPEHVEMALLSNILAAYSFVSENPERAALYFVSGVCIGLVLTLA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 17 kDa
• Gene Name: eva-1 homolog A, regulator of programmed cell death
• Database Link:
  NP_115557
  Entrez Gene 84141 Human
  UniProt ID Q9H8M9
• Background: EVA1A belongs to the FAM176 family. It acts as a regulator of programmed cell death, mediating both autophagy and apoptosis.
• Synonyms: FAM176A; TMEM166
• Note: Immunogen Sequence Homology: Dog: 100%; Horse: 100%; Human: 100%; Rabbit: 93%; Pig: 86%; Guinea pig: 86%; Mouse: 79%

Reference Data

• Protein Families: Transmembrane