Sprouty 4 (SPRY4) Rabbit Polyclonal Antibody

CAT#: TA339762

Rabbit Polyclonal Anti-SPRY4 Antibody

Product Images

WB Suggested Anti-SPRY4 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: Hela cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SPRY4 antibody: synthetic peptide directed towards the middle region of human SPRY4. Synthetic peptide located within the following region: LCYLPATGCVKLAQRGYDRLRRPGCRCKHTNSVICKAASGDAKTSRPDKP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 35 kDa
• Gene Name: sprouty RTK signaling antagonist 4
• Database Link:
  NP_112226
  Entrez Gene 81848 Human
  UniProt ID Q9C004
• Background: SPRY4 is an inhibitor of the receptor-transduced mitogen-activated protein kinase (MAPK) signaling pathway. It is positioned upstream of RAS (see HRAS; MIM 190020) activation and impairs the formation of active GTP-RAS (Leeksma et al., 2002 [PubMed 12027893]).
• Synonyms: HH17
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 86%; Horse: 86%; Mouse: 86%; Bovine: 86%; Rabbit: 86%; Guinea pig: 86%; Rat: 79%

Reference Data

• Protein Pathways: Jak-STAT signaling pathway