ZSCAN5 (ZSCAN5A) Rabbit Polyclonal Antibody

CAT#: TA339859

Rabbit Polyclonal Anti-ZSCAN5A Antibody

Product Images

Host: Rabbit; Target Name: ZSCAN5A; Sample Tissue: Fetal Liver lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ZSCAN5A antibody is: synthetic peptide directed towards the middle region of human ZSCAN5A. Synthetic peptide located within the following region: GNRGDALNLSSPKRSKPDASSISQEEPQGEATPVGNRESPGQAGMNSIHS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 38 kDa
• Gene Name: zinc finger and SCAN domain containing 5A
• Database Link:
  NP_077279
  Entrez Gene 79149 Human
  UniProt ID Q9BUG6
• Background: The function of this protein remains unknown.
• Synonyms: ZNF495; ZSCAN5
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Transcription Factors