TEC Rabbit Polyclonal Antibody

CAT#: TA339892

Rabbit Polyclonal Anti-TEC Antibody

Product Images

WB Suggested Anti-TEC Antibody Titration: 0.2-1 ug/ml; Positive Control: THP-1 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TEC antibody: synthetic peptide directed towards the middle region of human TEC. Synthetic peptide located within the following region: VKVSDFGMARYVLDDQYTSSSGAKFPVKWCPPEVFNYSRFSSKSDVWSFG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 73 kDa
• Gene Name: tec protein tyrosine kinase
• Database Link:
  NP_003206
  Entrez Gene 7006 Human
  UniProt ID P42680
• Background: The protein encoded by this gene belongs to the Tec family of non-receptor protein-tyrosine kinases containing a pleckstrin homology domain. Tec family kinases are involved in the intracellular signaling mechanisms of cytokine receptors, lymphocyte surface antigens, heterotrimeric G-protein coupled receptors, and integrin molecules. They are also key players in the regulation of the immune functions. Tec kinase is an integral component of T cell signaling and has a distinct role in T cell activation. This gene may be associated with myelodysplastic syndrome.
• Synonyms: PSCTK4
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 85%

Reference Data

• Protein Families: Druggable Genome, Protein Kinase
• Protein Pathways: T cell receptor signaling pathway