OVCA1 (DPH1) Rabbit Polyclonal Antibody

CAT#: TA340017

Rabbit Polyclonal Anti-DPH1 Antibody

Product Images

WB Suggested Anti-DPH1 Antibody Titration: 0.2-1 ug/ml; Positive Control: MCF7 cell lysate DPH1 is supported by BioGPS gene expression data to be expressed in MCF7

• 

  Rabbit Anti-DPH1 Antibody; Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver; Observed Staining: Cytoplasm (perinuclear) but not nuclear in hepatocytes, strong signal, low tissue distribution; Primary Antibody Concentration: 1: 100; Secondary Ant

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-DPH1 antibody: synthetic peptide directed towards the middle region of human DPH1. Synthetic peptide located within the following region: RMQAARQEAIATARSAKSWGLILGTLGRQGSPKILEHLESRLRALGLSFV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 49 kDa
• Gene Name: diphthamide biosynthesis 1
• Database Link:
  NP_001374
  Entrez Gene 1801 Human
  UniProt ID Q9BZG8
• Background: Diphthamide is a unique posttranslationally modified histidine found only in translation elongation factor-2 (EEF2; MIM 130610). This modification is conserved from archaebacteria to humans and serves as the target for ADP-ribosylation and inactivation of EEF2 by diphtheria toxin (DT) and Pseudomonas exotoxin A. DPH1 is 1 of several enzymes involved in synthesis of diphthamide in EEF2 (Liu et al., 2004 [PubMed 15485916]). Diphthamide is a unique posttranslationally modified histidine found only in translation elongation factor-2 (EEF2; MIM 130610). This modification is conserved from archaebacteria to humans and serves as the target for ADP-ribosylation and inactivation of EEF2 by diphtheria toxin (DT) and Pseudomonas exotoxin A. DPH1 is 1 of several enzymes involved in synthesis of diphthamide in EEF2 (Liu et al., 2004 [PubMed 15485916]). [supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-40 AF321876.1 1-40 41-1028 BC003099.1 3-990 1029-1410 BP417755.1 78-459 1411-2188 AK090530.1 1484-2261 2189-2200 AF321876.1 2189-2200
• Synonyms: DPH2L; DPH2L1; OVCA1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%; Yeast: 83%