CRMP4 (DPYSL3) Rabbit Polyclonal Antibody

CAT#: TA340020

Rabbit Polyclonal Anti-DPYSL3 Antibody

Product Images

WB Suggested Anti-DPYSL3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: Transfected 293T

• 

  Immunohistochemistry with Small intestine, submucosal plexus tissue

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-DPYSL3 antibody: synthetic peptide directed towards the middle region of human DPYSL3. Synthetic peptide located within the following region: VFDLTTTPKGGTPAGSARGSPTRPNPPVRNLHQSGFSLSGTQVDEGVRSA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 62 kDa
• Gene Name: dihydropyrimidinase like 3
• Database Link:
  NP_001378
  Entrez Gene 1809 Human
  UniProt ID Q14195
• Background: DPYSL3 is necessary for signaling by class 3 semaphorins and subsequent remodeling of the cytoskeleton. DPYSL3 plays a role in axon guidance, neuronal growth cone collapse and cell migration.
• Synonyms: CRMP-4; CRMP4; DRP-3; DRP3; LCRMP; ULIP; ULIP-1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Horse: 93%; Rabbit: 93%