EEF1B2 Rabbit Polyclonal Antibody

CAT#: TA340194

Rabbit Polyclonal Anti-EEF1B2 Antibody

Product Images

WB Suggested Anti-EEF1B2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 12500; Positive Control: 293T cell lysateEEF1B2 is supported by BioGPS gene expression data to be expressed in HEK293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-EEF1B2 antibody: synthetic peptide directed towards the middle region of human EEF1B2. Synthetic peptide located within the following region: VKKALGKYGPADVEDTTGSGATDSKDDDDIDLFGSDDEEESEEAKRLREE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 25 kDa
• Gene Name: eukaryotic translation elongation factor 1 beta 2
• Database Link:
  NP_066944
  Entrez Gene 1933 Human
  UniProt ID P24534
• Background: EEF1B2 is a translation elongation factor. The protein is a guanine nucleotide exchange factor involved in the transfer of aminoacylated tRNAs to the ribosome. This gene encodes a translation elongation factor. The protein is a guanine nucleotide exchange factor involved in the transfer of aminoacylated tRNAs to the ribosome. Alternative splicing results in three transcript variants which differ only in the 5' UTR.
• Synonyms: EEF1B; EEF1B1; EF1B
• Note: Immunogen Sequence Homology: Horse: 100%; Human: 100%; Rabbit: 100%; Dog: 93%; Pig: 93%; Guinea pig: 93%; Goat: 86%; Bovine: 86%; Mouse: 85%