RFTN2 Rabbit Polyclonal Antibody

CAT#: TA340342

Rabbit Polyclonal Anti-RFTN2 Antibody

Product Images

WB Suggested Anti-RFTN2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: HT1080 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RFTN2 antibody: synthetic peptide directed towards the N terminal of human RFTN2. Synthetic peptide located within the following region: MGCGLRKLEDPDDSSPGKIFSTLKRPQVETKTEFAYEYVLLDFTLQASSN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 56 kDa
• Gene Name: raftlin family member 2
• Database Link:
  NP_653230
  Entrez Gene 130132 Human
  UniProt ID Q52LD8
• Background: The function of the protein remains unknown.
• Synonyms: C2orf11; Raftlin-2
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Rat: 93%; Mouse: 93%; Zebrafish: 93%; Guinea pig: 86%