CREB3L1 Rabbit Polyclonal Antibody

CAT#: TA341434

Rabbit Polyclonal Anti-CREB3L1 Antibody

Product Images

WB Suggested Anti-CREB3L1 Antibody Titration: 1.25 ug/ml; ELISA Titer: 1:1562500; Positive Control: Human Small Intestine

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CREB3L1 antibody: synthetic peptide directed towards the N terminal of human CREB3L1. Synthetic peptide located within the following region: FTENMEDFSNDLFSSFFDDPVLDEKSPLLDMELDSPTPGIQAEHSYSLSG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 57 kDa
• Gene Name: cAMP responsive element binding protein 3-like 1
• Database Link:
  NP_443086
  Entrez Gene 90993 Human
  UniProt ID Q96BA8
• Background: The protein encoded byThis gene is normally found inThe membrane ofThe endoplasmic reticulum (ER). However, upon stress toThe ER,The encoded protein is cleaved andThe released cytoplasmic transcription factor domain translocates toThe nucleus.There it activatesThe transcription of target genes by binding to box-B elements. [provided by RefSeq, Jun 2013]
• Synonyms: OASIS
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 93%; Guinea pig: 93%

Reference Data

• Protein Families: Transcription Factors
• Protein Pathways: Huntington's disease, Melanogenesis, Prostate cancer