MCM6 Rabbit Polyclonal Antibody

CAT#: TA341686

Rabbit Polyclonal Anti-MCM6 Antibody

Product Images

WB Suggested Anti-MCM6 Antibody Titration: 1.25 ug/ml; Positive Control: HepG2 cell lysate

• 

  Human Lung

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MCM6 antibody: synthetic peptide directed towards the C terminal of human MCM6. Synthetic peptide located within the following region: RIIEKVIHRLTHYDHVLIELTQAGLKGSTEGSESYEEDPYLVVNPNYLLE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 90 kDa
• Gene Name: minichromosome maintenance complex component 6
• Database Link:
  NP_005906
  Entrez Gene 4175 Human
  UniProt ID Q14566
• Background: The protein encoded byThis gene is one ofThe highly conserved mini-chromosome maintenance proteins (MCM) that are essential forThe initiation of eukaryotic genome replication.The hexameric protein complex formed byThe MCM proteins is a key component ofThe pre-replication complex (pre_RC) and may be involved inThe formation of replication forks and inThe recruitment of other DNA replication related proteins.The MCM complex consisting ofThis protein and MCM2, 4 and 7 proteins possesses DNA helicase activity, and may act as a DNA unwinding enzyme.The phosphorylation ofThe complex by CDC2 kinase reducesThe helicase activity, suggesting a role inThe regulation of DNA replication. Single nucleotide polymorphisms inThe intron regions ofThis gene are associated with differential transcriptional activation ofThe promoter ofThe neighboring lactase gene and,Thereby, influence lactose intolerance in early adulthood. [provided by RefSeq, May 2012]
• Synonyms: MCG40308; Mis5; P105MCM
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Rat: 93%; Mouse: 93%

Reference Data

• Protein Families: Stem cell - Pluripotency, Transcription Factors
• Protein Pathways: Cell cycle, DNA replication