Lyl1 Rabbit Polyclonal Antibody

CAT#: TA341789

Rabbit Polyclonal Anti-Lyl1 Antibody

Product Images

Host: Rabbit; Target Name: Lyl1; Sample Tissue: Rat Spleen lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Lyl1 antibody is: synthetic peptide directed towards the C-terminal region of Rat Lyl1. Synthetic peptide located within the following region: GVEGNARCGAGHRVEAARSQPVLPGDCDGDPNGSVRPIKMEQTALSPEVR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 30 kDa
• Gene Name: lymphoblastic leukemia associated hematopoiesis regulator 1
• Database Link:
  NP_001007678
  Entrez Gene 304663 Rat
  UniProt ID Q66HH3
• Background: The function ofThis protein remains unknown.
• Synonyms: bHLHa18
• Note: Immunogen Sequence Homology: Mouse: 100%; Rat: 86%