Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-Lyl-1 antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Lyl-1. |
Antibodies
View as table Download
Lyl1 rat monoclonal antibody, clone KT43, Aff - Purified
| Applications | IP, WB |
| Reactivities | Mouse |
Lyl1 rat monoclonal antibody, clone KT43, Aff - Purified
| Applications | IP, WB |
| Reactivities | Mouse |
Lyl1 rat monoclonal antibody, clone KT43, Aff - Purified
| Applications | IP, WB |
| Reactivities | Mouse |
Rabbit Polyclonal Anti-Lyl1 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Lyl1 antibody is: synthetic peptide directed towards the C-terminal region of Rat Lyl1. Synthetic peptide located within the following region: GVEGNARCGAGHRVEAARSQPVLPGDCDGDPNGSVRPIKMEQTALSPEVR |
Rabbit Polyclonal anti-LYL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-LYL1 antibody is: synthetic peptide directed towards the C-terminal region of Human LYL1. Synthetic peptide located within the following region: PDDGARRGSGRRAEAAARSQPAPPADPDGSPGGAARPIKMEQTALSPEVR |
Rabbit Polyclonal anti-LYL1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LYL1 antibody: synthetic peptide directed towards the C terminal of human LYL1. Synthetic peptide located within the following region: PDDGARRGSGRRAEAAARSQPAPPADPDGSPGGAARPIKMEQTALSPEVR |
Rabbit Polyclonal Anti-LYL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LYL1 antibody: synthetic peptide directed towards the N terminal of human LYL1. Synthetic peptide located within the following region: ASPGPPQVEEVGHRGGSSPPRLPPGVPVISLGHSRPPGVAMPTTELGTLR |
Active filters
Target Symbol
- LYL1