Nkx2.5 (NKX2-5) Rabbit Polyclonal Antibody

CAT#: TA341802

Rabbit Polyclonal Anti-Nkx2-5 Antibody

Product Images

WB Suggested Anti-Nkx2-5 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Mouse Thymus

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Nkx2-5 antibody: synthetic peptide directed towards the n terminal of mouse Nkx2-5. Synthetic peptide located within the following region: MFPSPALTPTPFSVKDILNLEQQQRSLASGDLSARLEATLAPASCMLAAF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 34 kDa
• Gene Name: NK2 homeobox 5
• Database Link:
  NP_004378
  Entrez Gene 18091 Mouse
  UniProt ID P52952
• Background: Homeobox-containing genes play critical roles in regulating tissue-specific gene expression essential for tissue differentiation, as well as determiningThe temporal and spatial patterns of development. It has been demonstrated that a Drosophila homeobox-containing gene called 'tinman' is expressed inThe developing dorsal vessel and inThe equivalent ofThe vertebrate heart. Mutations in tinman result in loss of heart formation inThe embryo, suggesting that tinman is essential for Drosophila heart formation. Furthermore, abundant expression of Csx,The presumptive mouse homolog of tinman, is observed only inThe heart fromThe time of cardiac differentiation. CSX,The human homolog of murine Csx, has a homeodomain sequence identical to that of Csx and is expressed only inThe heart, again suggesting that CSX plays an important role in human heart formation.
• Synonyms: CHNG5; CSX; CSX1; HLHS2; NKX2.5; NKX2E; NKX4-1; VSD3
• Note: Immunogen Sequence Homology: Mouse: 100%; Rat: 93%; Dog: 86%; Pig: 86%; Bovine: 86%; Rabbit: 86%; Guinea pig: 86%; Human: 80%

Reference Data

• Protein Families: Transcription Factors