Rel B (RELB) Rabbit Polyclonal Antibody

CAT#: TA341809

Rabbit Polyclonal Anti-RELB Antibody

Product Images

WB Suggested Anti-RELB Antibody Titration: 2.5 ug/ml; ELISA Titer: 1:1562500; Positive Control: Human Thymus

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RELB antibody: synthetic peptide directed towards the middle region of mouse RELB. Synthetic peptide located within the following region: FLQRLTDGVCSEPLPFTYLPRDHDSYGVDKKRKRGLPDVLGELSSSDPHG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 61 kDa
• Gene Name: RELB proto-oncogene, NF-kB subunit
• Database Link:
  NP_006500
  Entrez Gene 5971 Human
  UniProt ID Q01201
• Background: RelB is a member ofThe Rel/nuclear factor (NF)-kappa B family of transcription factors, defects in RelB affects antigen presenting cells andThe formation of lymphoid organs. Targeted disruption ofThe Rel/NF-kappaB family members NF-kappaB2, encoding p100/p52, and RelB in mice results in anatomical defects of secondary lymphoid tissues.
• Synonyms: I-REL; IREL; REL-B
• Note: Immunogen Sequence Homology: Rat: 100%; Mouse: 100%; Bovine: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Human: 93%; Rabbit: 93%; Guinea pig: 93%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors
• Protein Pathways: MAPK signaling pathway