VAX1 Rabbit Polyclonal Antibody

CAT#: TA341826

Rabbit Polyclonal Anti-Vax1 Antibody

Product Images

WB Suggested Anti-Vax1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Mouse Lung

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Vax1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: MFGKPDKMDVRCHSDTEAARVSKNAHKESREIKGAEGSLPAAFLKEPQGA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 35 kDa
• Gene Name: ventral anterior homeobox 1
• Database Link:
  NP_001106175
  Entrez Gene 22326 Mouse
  UniProt ID Q5SQQ9
• Background: Vax1 is required for axon guidance and major tract formation inThe developing forebrain. Vax1 may contribute toThe differentiation ofThe neuroretina, pigmented epithelium and optic stalk.
• Synonyms: MCOPS11
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Dog: 93%; Human: 93%

Reference Data

• Protein Families: Transcription Factors