emopamil binding protein (EBP) Rabbit Polyclonal Antibody

CAT#: TA341847

Rabbit Polyclonal Anti-EBP Antibody

Product Images

WB Suggested Anti-EBP Antibody Titration: 0.2-1 ug/ml; Positive Control: Jurkat cell lysate.EBP is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-EBP antibody: synthetic peptide directed towards the N terminal of human EBP. Synthetic peptide located within the following region: LVIEGWFVLYYEDLLGDQAFLSQLWKEYAKGDSRYILGDNFTVCMETITA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 26 kDa
• Gene Name: emopamil binding protein (sterol isomerase)
• Database Link:
  NP_006570
  Entrez Gene 10682 Human
  UniProt ID Q15125
• Background: The protein encoded byThis gene is an integral membrane protein ofThe endoplasmic reticulum. It is a high affinity binding protein forThe antiischemic phenylalkylamine Ca2+ antagonist [3H]emopamil andThe photoaffinity label [3H]azidopamil. It is similar to sigma receptors and may be a member of a superfamily of high affinity drug-binding proteins inThe endoplasmic reticulum of different tissues.This protein shares structural features with bacterial and eukaryontic drug transporting proteins. It has four putative transmembrane segments and contains two conserved glutamate residues which may be involved inThe transport of cationic amphiphilics. Another prominent feature ofThis protein is its high content of aromatic amino acid residues (>23%) in its transmembrane segments.These aromatic amino acid residues have been suggested to be involved inThe drug transport byThe P-glycoprotein. Mutations inThis gene cause Chondrodysplasia punctata 2 (CDPX2; also known as Conradi-Hunermann syndrome). [provided by RefSeq, Jul 2008]
• Synonyms: CDPX2; CHO2; CPX; CPXD
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 86%; Rat: 85%; Mouse: 85%

Reference Data

• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Metabolic pathways, Steroid biosynthesis