PILRB Rabbit Polyclonal Antibody

CAT#: TA341920

Rabbit Polyclonal Anti-PILRB Antibody

Product Images

WB Suggested Anti-PILRB Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Human Muscle

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PILRB antibody: synthetic peptide directed towards the middle region of human PILRB. Synthetic peptide located within the following region: KLTITQAVTTTTTWRPSSTTTIAGLRVTESKGHSESWHLSLDTAIRVALA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 23 kDa
• Gene Name: paired immunoglobin-like type 2 receptor beta
• Database Link:
  NP_038468
  Entrez Gene 29990 Human
  UniProt ID Q9UKJ0
• Background: The paired immunoglobin-like type 2 receptors consist of highly related activating and inhibitory receptors that are involved inThe regulation of many aspects ofThe immune system.The paired immunoglobulin-like receptor genes are located in a tandem head-to-tail orientation on chromosome 7.This gene encodesThe activating member ofThe receptor pair and contains a truncated cytoplasmic tail relative to its inhibitory counterpart (PILRA), that has a long cytoplasmic tail with immunoreceptor tyrosine-based inhibitory (ITIM) motifs.This gene is thought to have arisen from a duplication ofThe inhibitory PILRA gene and evolved to acquire its activating function. [provided by RefSeq, Jun 2013]
• Synonyms: FDFACT1; FDFACT2
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Druggable Genome, Transmembrane