PILRB Rabbit Polyclonal Antibody

CAT#: TA341920

Rabbit Polyclonal Anti-PILRB Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "PILRB"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-PILRB antibody: synthetic peptide directed towards the middle region of human PILRB. Synthetic peptide located within the following region: KLTITQAVTTTTTWRPSSTTTIAGLRVTESKGHSESWHLSLDTAIRVALA
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 23 kDa
Gene Name paired immunoglobin-like type 2 receptor beta
Background The paired immunoglobin-like type 2 receptors consist of highly related activating and inhibitory receptors that are involved inThe regulation of many aspects ofThe immune system.The paired immunoglobulin-like receptor genes are located in a tandem head-to-tail orientation on chromosome 7.This gene encodesThe activating member ofThe receptor pair and contains a truncated cytoplasmic tail relative to its inhibitory counterpart (PILRA), that has a long cytoplasmic tail with immunoreceptor tyrosine-based inhibitory (ITIM) motifs.This gene is thought to have arisen from a duplication ofThe inhibitory PILRA gene and evolved to acquire its activating function. [provided by RefSeq, Jun 2013]
Synonyms FDFACT1; FDFACT2
Note Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Families Druggable Genome, Transmembrane

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.