Hephaestin (HEPH) Rabbit Polyclonal Antibody

CAT#: TA341959

Rabbit Polyclonal Anti-HEPH Antibody

Product Images

WB Suggested Anti-HEPH Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: MCF7 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-HEPH antibody: synthetic peptide directed towards the N terminal of human HEPH. Synthetic peptide located within the following region: MHAINGFVFGNLPELNMCAQKRVAWHLFGMGNEIDVHTAFFHGQMLTTRG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 100 kDa
• Gene Name: hephaestin
• Database Link:
  NP_055614
  Entrez Gene 9843 Human
• Background: This gene encodes a member ofThe multicopper oxidase protein family.The encoded protein is involved inThe transport of dietary iron from epithelial cells ofThe intestinal lumen intoThe circulatory system, and may be involved in copper transport and homeostasis. In mouse, defects inThis gene can lead to severe microcytic anemia. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2013]
• Synonyms: CPL
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Sheep: 93%; Bovine: 93%; Guinea pig: 93%; Rabbit: 86%; Zebrafish: 79%

Reference Data

• Protein Families: Druggable Genome, Transmembrane