Calcyon (CALY) Rabbit Polyclonal Antibody

CAT#: TA341984

Rabbit Polyclonal Anti-Caly Antibody

Product Images

WB Suggested Anti-Caly Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Rat Lung

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Caly antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: RHRSILAAIGAYPLSRKHGTEMPAIWGNSYRAGKEEHKGTTPAAMTVSTA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 25 kDa
• Gene Name: calcyon neuron specific vesicular protein
• Database Link:
  NP_056537
  Entrez Gene 50632 Human
  UniProt ID Q9NYX4
• Background: dopamine receptor 1 (D1R) of D1-like receptors interacting protein [RGD, Feb 2006]. Transcript Variant:This variant (1) representsThe longer variant. Both variants 1 and 2 encodeThe same protein. ##Evidence-Data-START## Transcript exon combination :: AF303658.1 [ECO:0000332] RNAseq introns :: mixed/partial sample support ERS160522, ERS160537 [ECO:0000350] ##Evidence-Data-END##
• Synonyms: DRD1IP; NSG3
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Bovine: 86%

Reference Data

• Protein Families: Druggable Genome, Transmembrane