SIGLECL1 (SIGLEC12) Rabbit Polyclonal Antibody
Other products for "SIGLEC12"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-SIGLEC12 antibody: synthetic peptide directed towards the N terminal of human SIGLEC12. Synthetic peptide located within the following region: LCVSVLCSFSYPQNGWTASDPVHGYWFRAGDHVSRNIPVATNNPARAVQE |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 63 kDa |
Gene Name | sialic acid binding Ig like lectin 12 (gene/pseudogene) |
Database Link | |
Background | Sialic acid-binding immunoglobulin-like lectins (SIGLECs) are a family of cell surface proteins belonging toThe immunoglobulin superfamily.They mediate protein-carbohydrate interactions by selectively binding to different sialic acid moieties present on glycolipids and glycoproteins. SIGLEC12 is a member ofThe SIGLEC3-like subfamily of SIGLECs. SIGLEC12, upon tyrosine phosphorylation, has been shown to recruitThe Src homology 2 domain-containing protein-tyrosine phosphatases SHP1 and SHP2. It has been suggested thatThe protein is involved inThe negative regulation of macrophage signaling by functioning as an inhibitory receptor.Western blots using four different antibodies against four unique regions ofThis protein target confirmThe same apparent molecular weight in our tests.Sialic acid-binding immunoglobulin-like lectins (SIGLECs) are a family of cell surface proteins belonging toThe immunoglobulin superfamily.They mediate protein-carbohydrate interactions by selectively binding to different sialic acid moieties present on glycolipids and glycoproteins.This gene encodes a member ofThe SIGLEC3-like subfamily of SIGLECs. Members ofThis subfamily are characterized by an extracellular V-set immunoglobulin-like domain followed by two C2-set immunoglobulin-like domains, andThe cytoplasmic tyrosine-based motifs ITIM and SLAM-like.The encoded protein, upon tyrosine phosphorylation, has been shown to recruitThe Src homology 2 domain-containing protein-tyrosine phosphatases SHP1 and SHP2. It has been suggested thatThe protein is involved inThe negative regulation of macrophage signaling by functioning as an inhibitory receptor.This gene is located in a cluster with other SIGLEC3-like genes on 19q13.4. Alternatively spliced transcript variants encoding distinct isoforms have been described forThis gene. |
Synonyms | S2V; Siglec-XII; SIGLECL1; SLG |
Note | Immunogen Sequence Homology: Human: 100% |
Reference Data | |
Protein Families | Druggable Genome, Stem cell - Pluripotency, Transmembrane |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.