MOGT1 (MOGAT1) Rabbit Polyclonal Antibody

CAT#: TA342082

Rabbit Polyclonal Anti-MOGAT1 Antibody

Product Images

WB Suggested Anti-MOGAT1 Antibody Titration: 0.2-1 ug/ml; Positive Control: Human Liver

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MOGAT1 antibody: synthetic peptide directed towards the C terminal of human MOGAT1. Synthetic peptide located within the following region: PIPVRQTLNPTQEQIEELHQTYMEELRKLFEEHKGKYGIPEHETLVLK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 39 kDa
• Gene Name: monoacylglycerol O-acyltransferase 1
• Database Link:
  NP_477513
  Entrez Gene 116255 Human
  UniProt ID Q96PD6
• Background: Acyl-CoA:monoacylglycerol acyltransferase (MOGAT; EC 2.3.1.22) catalyzesThe synthesis of diacylglycerols,The precursor of physiologically important lipids such as triacylglycerol and phospholipids.Acyl-CoA:monoacylglycerol acyltransferase (MOGAT; EC 2.3.1.22) catalyzesThe synthesis of diacylglycerols,The precursor of physiologically important lipids such as triacylglycerol and phospholipids (Yen et al., 2002 [PubMed 12077311]). [supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-48 AF384163.1 1-48 49-1056 BN000154.1 1-1008 1057-1096 AF384163.1 1054-1093
• Synonyms: DGAT2L; DGAT2L1; MGAT1
• Note: Immunogen Sequence Homology: Pig: 100%; Human: 100%; Mouse: 100%; Bovine: 93%; Dog: 92%; Rat: 86%; Guinea pig: 86%; Horse: 79%

Reference Data

• Protein Families: Transmembrane