B3GALT6 Rabbit Polyclonal Antibody

CAT#: TA342088

Rabbit Polyclonal Anti-B3GALT6 Antibody

Product Images

WB Suggested Anti-B3GALT6 Antibody Titration: 0.2-1 ug/ml; Positive Control: Human Liver

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-B3GALT6 antibody: synthetic peptide directed towards the N terminal of human B3GALT6. Synthetic peptide located within the following region: EREQARHGDLLLLPALRDAYENLTAKVLAMLAWLDEHVAFEFVLKADDDS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 37 kDa
• Gene Name: beta-1,3-galactosyltransferase 6
• Database Link:
  NP_542172
  Entrez Gene 126792 Human
  UniProt ID Q96L58
• Background: B3GALT6 (Beta-1,3-galactosyltransferase) transfers galactose from UDP-galactose to substrates with a terminal beta-linked galactose residue. It has a preference for galactose-beta-1,4-xylose that is found inThe linker region of glycosaminoglycans, such as heparan sulfate and chondroitin sulfate. It has no activity towards substrates with terminal glucosamine or galactosamine residues.
• Synonyms: beta3GalT6; EDSP2; SEMDJL1
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Pig: 93%; Bovine: 93%; Guinea pig: 93%; Zebrafish: 77%

Reference Data

• Protein Families: Transmembrane
• Protein Pathways: Chondroitin sulfate biosynthesis, Heparan sulfate biosynthesis, Metabolic pathways