B3GALT6 Rabbit Polyclonal Antibody

CAT#: TA342088

Rabbit Polyclonal Anti-B3GALT6 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "B3GALT6"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-B3GALT6 antibody: synthetic peptide directed towards the N terminal of human B3GALT6. Synthetic peptide located within the following region: EREQARHGDLLLLPALRDAYENLTAKVLAMLAWLDEHVAFEFVLKADDDS
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 37 kDa
Gene Name beta-1,3-galactosyltransferase 6
Background B3GALT6 (Beta-1,3-galactosyltransferase) transfers galactose from UDP-galactose to substrates with a terminal beta-linked galactose residue. It has a preference for galactose-beta-1,4-xylose that is found inThe linker region of glycosaminoglycans, such as heparan sulfate and chondroitin sulfate. It has no activity towards substrates with terminal glucosamine or galactosamine residues.
Synonyms beta3GalT6; EDSP2; SEMDJL1
Note Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Pig: 93%; Bovine: 93%; Guinea pig: 93%; Zebrafish: 77%
Reference Data
Protein Families Transmembrane
Protein Pathways Chondroitin sulfate biosynthesis, Heparan sulfate biosynthesis, Metabolic pathways

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.